PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015873010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 309aa    MW: 34311.1 Da    PI: 7.9664
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015873010.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.61.7e-4039100263
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                     +e+alkcprCdstntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  XP_015873010.1  39 PEQALKCPRCDSTNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 100
                     6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-302797IPR003851Zinc finger, Dof-type
PfamPF027016.2E-344197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5814397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MSYKIFLLKI SPQEMPSHSL ENMLVNTKAQ QERKPRPHPE QALKCPRCDS TNTKFCYYNN  60
YSLTQPRYFC KSCRRYWTKG GTLRNVPVGG GCRKNKRSSS SSSSSSSKRV QDQPLTPNSN  120
PLSNLPPLTY DSNDLTLAFA RLQKQSCGQL GYDEHDLSIL GNPTSTHCDI LGNPSGINTT  180
NPAGFIDAMR NGFLESQNHY QNLYYGFGNG NIGEVENGGG GVSSEMGLHP YEEISSNAAT  240
TTAVTVTTMK QELCHGRDNE NRILWGFPWQ MNNNGGDHHG NNLGDFDTGR ESWNGMTPSW  300
HGLLNSPLM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015873010.10.0PREDICTED: dof zinc finger protein DOF2.1-like
TrEMBLA0A0K8K6351e-147A0A0K8K635_CAJCA; Dof protein
STRINGGLYMA12G07710.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50263051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.15e-41TARGET OF MONOPTEROS 6